PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G59450.1
Common NameF2O15.5, SCL11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 610aa    MW: 69768.5 Da    PI: 6.0287
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G59450.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS412.24.6e-1262245981374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                  l++lL++cA+av+s d+++a+  L++++ ++s++gd +qRla+yf+eAL+ar+++  ++ +++ +p+s+ts   +++ l+a+klf++++Pi+   +++
  AT5G59450.1 224 LRSLLTQCAQAVASFDQRRATDKLKEIRAHSSSNGDGTQRLAFYFAEALEARITGnISPPVSNPFPSSTTS---MVDILKAYKLFVHTCPIYVTDYFA 318
                  6899***************************************************6777888777777777...************************ PP

         GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  aN+ I+e + +++++Hi+Df++ +G+QWp+Ll+aL++Rp+gpp+lR+Tg++ p++g   ++++eetg+rL++f+++++vpfefn+ +ak++e+++l+e
  AT5G59450.1 319 ANKSIYELAMKATKLHIVDFGVLYGFQWPCLLRALSKRPGGPPMLRVTGIELPQAGfrPSDRVEETGRRLKRFCDQFNVPFEFNF-IAKKWETITLDE 415
                  *******************************************************9*****************************.7*********** PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres..eerikvErel 289
                  L ++pgE+++Vn++++l++++de+vsl+s+rd+vLkl+++++P+++v++e +  +ns+ F++rf eal +ys+lfd++++++++e+  ++r+ +Erel
  AT5G59450.1 416 LMINPGETTVVNCIHRLQYTPDETVSLDSPRDTVLKLFRDINPDLFVFAEINGMYNSPFFMTRFREALFHYSSLFDMFDTTIHAEDeyKNRSLLEREL 513
                  *********************************************************************************99999899********* PP

         GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  l r++++v++cegaer++r et+++Wr r+ +aGFkp+++s++++k+ak ++rk + + + ++++++++++gWk+r ++++S+W+
  AT5G59450.1 514 LVRDAMSVISCEGAERFARPETYKQWRVRILRAGFKPATISKQIMKEAKEIVRKRYHRDFVIDSDNNWMLQGWKGRVIYAFSCWK 598
                  ********************************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.568198578IPR005202Transcription factor GRAS
PfamPF035141.6E-123224598IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MDALLQVSVD GFRFENGSGS CCKPRNNLES GNNLFPDFHE SQNQSSPNDS PPTVCLDNSP  60
VLKYINDMLM DEEDFVGISR DDLALQAAER SFYEIIQQQS PESDQNTSSS SDQNSGDQDF  120
CFPSTTTDSS ALVSSGESQR KYRHRNDEED DLENNRRNKQ PAIFVSEMEE LAVKLEHVLL  180
VCKTNQEEEE ERTVITKQST PNRAGRAKGS SNKSKTHKTN TVDLRSLLTQ CAQAVASFDQ  240
RRATDKLKEI RAHSSSNGDG TQRLAFYFAE ALEARITGNI SPPVSNPFPS STTSMVDILK  300
AYKLFVHTCP IYVTDYFAAN KSIYELAMKA TKLHIVDFGV LYGFQWPCLL RALSKRPGGP  360
PMLRVTGIEL PQAGFRPSDR VEETGRRLKR FCDQFNVPFE FNFIAKKWET ITLDELMINP  420
GETTVVNCIH RLQYTPDETV SLDSPRDTVL KLFRDINPDL FVFAEINGMY NSPFFMTRFR  480
EALFHYSSLF DMFDTTIHAE DEYKNRSLLE RELLVRDAMS VISCEGAERF ARPETYKQWR  540
VRILRAGFKP ATISKQIMKE AKEIVRKRYH RDFVIDSDNN WMLQGWKGRV IYAFSCWKPA  600
EKFTNNNLNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-442245985375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.292250.0floral meristem| flower| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO143346550.0
Genevisible247707_at0.0
Expression AtlasAT5G59450-
AtGenExpressAT5G59450-
ATTED-IIAT5G59450-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in roots and at lower levels in leaves and sepals. Expressed in siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G59450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G59450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256040.0AB025604.1 Arabidopsis thaliana genomic DNA, chromosome 5, BAC clone:F2O15.
GenBankAY0350010.0AY035001.1 Arabidopsis thaliana putative scarecrow 11 protein (At5g59450) mRNA, complete cds.
GenBankAY0629420.0AY062942.1 Arabidopsis thaliana putative scarecrow 11 protein (At5g59450) mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200753.10.0GRAS family transcription factor
SwissprotQ9LTI50.0SCL11_ARATH; Scarecrow-like protein 11
TrEMBLD7MSF00.0D7MSF0_ARALL; Putative uncharacterized protein
STRINGAT5G59450.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36462561
Representative plantOGRP26615129
Publications ? help Back to Top
  1. Pysh LD,Wysocka-Diller JW,Camilleri C,Bouchez D,Benfey PN
    The GRAS gene family in Arabidopsis: sequence characterization and basic expression analysis of the SCARECROW-LIKE genes.
    Plant J., 1999. 18(1): p. 111-9
    [PMID:10341448]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Menges M,Hennig L,Gruissem W,Murray JA
    Cell cycle-regulated gene expression in Arabidopsis.
    J. Biol. Chem., 2002. 277(44): p. 41987-2002
    [PMID:12169696]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  6. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  7. Wang R, et al.
    Genomic analysis of the nitrate response using a nitrate reductase-null mutant of Arabidopsis.
    Plant Physiol., 2004. 136(1): p. 2512-22
    [PMID:15333754]
  8. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  9. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  10. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  11. Ronceret A, et al.
    The first zygotic division in Arabidopsis requires de novo transcription of thymidylate kinase.
    Plant J., 2008. 53(5): p. 776-89
    [PMID:18036198]
  12. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]